PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC8601_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 290aa    MW: 31990.4 Da    PI: 8.7583
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC8601_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.5e-3847106463
      zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                 +a+kcprC+s ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+r+nk+sss
  RrC8601_p1  47 EAQKCPRCESPNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRRNKRSSS 106
                 6789****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-3248103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0549103IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-225198IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MDPQQEMSNE TLETILASST KGSNYKNIKK MEEEMKKKQG KGELGGEAQK CPRCESPNTK  60
FCYYNNYSLS QPRYFCKSCR RYWTKGGTLR NVPVGGGCRR NKRSSSFSKN INKPINFHND  120
PLHNPLITGM PSSFGYDSID LNLAFAALHK QSPSQATPSF GFGGDVSIYG NSTNTHSGVL  180
GNGLNFGGRN GNFNSGSFWY GFMSGNENEN ESKTTSSLGI SLEENERKQE NVNNNNNNNI  240
LENPSKVLLG FPWQMTGNSA GGVPEIDLGR ESWNGLVSSW NNGLFNTPLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892990.0AC189299.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB028K05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013744165.11e-172PREDICTED: dof zinc finger protein DOF2.1-like
SwissprotQ8LE431e-125DOF21_ARATH; Dof zinc finger protein DOF2.1
TrEMBLA0A0D3C2L31e-162A0A0D3C2L3_BRAOL; Uncharacterized protein
STRINGBra035696.1-P1e-158(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69602743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.18e-99Dof family protein